SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041824 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041824
Domain Number 1 Region: 39-185
Classification Level Classification E-value
Superfamily PR-1-like 1.44e-36
Family PR-1-like 0.00022
Further Details:      
 
Domain Number 2 Region: 295-433
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-28
Family C-type lectin domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041824   Gene: ENSGALG00000027183   Transcript: ENSGALT00000046077
Sequence length 443
Comment pep:known chromosome:Galgal4:11:1183402:1189091:-1 gene:ENSGALG00000027183 transcript:ENSGALT00000046077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPGTCPARGGLLRPEVALGRQAGTQDWLVPPQILPSLPSPPFALSEKETFLVLSLHNKL
RSKVQPPAANMQKLEWSEELAQLAVARVAGCLEGPTPPPAPQLGWSEALLPVGAGGFVEL
LERWFAEGRRYDYGTARCAGNATCRHYTQLVWATAGRLGCGRQLCAGSRGRSQAFACAYS
PGGNWELAGAPIAPYQRGPWCSLCTAGLSGCFKSWDHGGGLCEVPRNPCRMSCRNGAHLN
VSSCQCVCAPGYTGRFCQVRCSMRCLHGKFRQEECSCLCDAGYGGAECGTRVPFPFHACD
VRIDGDCFTVSPEADTYYGAKAKCQEKGAMLAQIRSQKVQDILAFYLSRLESSNRVMDTD
FDTRNFWIGLTYKTSKASFRWDTGEPSAFASFAFGQPDNQGFGNCVEMQAAAAFNWNDQR
CKTRNRYICQFAQEHISRWQRDP
Download sequence
Identical sequences ENSGALP00000041824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]