SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041828 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041828
Domain Number 1 Region: 160-264
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-39
Family Link domain 0.0059
Further Details:      
 
Domain Number 2 Region: 269-353
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-24
Family Link domain 0.0025
Further Details:      
 
Domain Number 3 Region: 46-157
Classification Level Classification E-value
Superfamily Immunoglobulin 6.7e-16
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041828   Gene: ENSGALG00000015627   Transcript: ENSGALT00000045959
Sequence length 355
Comment pep:known chromosome:Galgal4:Z:62344745:62440821:1 gene:ENSGALG00000015627 transcript:ENSGALT00000045959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLLFLVLISVCWAEPHPDNSSLEHERIIHIQEENGPRLLVVAEQAKIFSQRGGNVTLP
CKFYHEHTSTAGSGTHKIRVKWTKLTSDYLKEVDVFVAMGHHRKSYGKYQGRVFLRESSE
NDASLIITNIMLEDYGRYKCEVIEGLEDDTAVVALNLEGVVFPYSPRLGRYNLNFHEAQQ
ACLDQDSIIASFDQLYEAWRSGLDWCNAGWLSDGSVQYPITKPREPCGGKNTVPGVRNYG
FWDKERSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLKDGAQIAKVGQIFAAWKLL
GYDRCDAGWLADGSVRYPISRPRKRCSPNEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences P07354
9031.ENSGALP00000025150 NP_990813.1.86415 XP_015136080.1.86415 XP_015136082.1.86415 XP_015136083.1.86415 XP_015136084.1.86415 ENSGALP00000025150 ENSGALP00000025150 ENSGALP00000041828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]