SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041839 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041839
Domain Number 1 Region: 35-216
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.88e-42
Family beta-glycanases 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041839   Gene: ENSGALG00000027851   Transcript: ENSGALT00000044442
Sequence length 257
Comment pep:novel scaffold:Galgal4:AADN03020125.1:21:1458:1 gene:ENSGALG00000027851 transcript:ENSGALT00000044442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPNSMHPPHGAHLGGAHLGVPTSAPRRPPALRAGLQYNLVRVPMASCDFSLHTYTYAD
VPDDFELRHFALRDEDTKLKIPLLRRAIAMAKRPLSIYGSPWTAPAWMKTSGSFVGKGTL
KGRAGGKYHRAWANYFVRFLDEYAKHNVTFWAVTAENEPTAGLINNYPFQCLGFTAEQQR
DFIARDLGPALANSSHRDVRLIILDDNRLHLPHWAKVVRVGRAVGWAWGGLWGGCGAGCG
VGVGRAVGWGGPLGCIF
Download sequence
Identical sequences ENSGALP00000041839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]