SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041954 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041954
Domain Number 1 Region: 27-209
Classification Level Classification E-value
Superfamily TIMP-like 1.96e-76
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041954   Gene: ENSGALG00000027070   Transcript: ENSGALT00000045529
Sequence length 220
Comment pep:known chromosome:Galgal4:18:10040657:10047611:1 gene:ENSGALG00000027070 transcript:ENSGALT00000045529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAALPSLLAWLAVLLLGRARPADACSCSPIHPQQAFCNADVVIRAKAVSAKEVDSGND
IYGNPIKRIQYEVKQIKMFKGPDQDIEFIYTAPSTAVCGQPLDTGGKKEYLIAGKSEGDG
KMHITLCDLVATWDSLSPTQKKSLNQRYQMGCECKISRCLSIPCFVSSSDECLWTDWAME
KIVGGRQAKHYACIKRSDGSCAWYRGMAPPKQEFLDIEDP
Download sequence
Identical sequences R4GIL5
ENSGALP00000041954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]