SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042033 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000042033
Domain Number - Region: 98-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.034
Family Complement control module/SCR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042033   Gene: ENSGALG00000026285   Transcript: ENSGALT00000044383
Sequence length 271
Comment pep:known_by_projection chromosome:Galgal4:20:5810986:5816101:1 gene:ENSGALG00000026285 transcript:ENSGALT00000044383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLERCARCLRARLVAAAVRRRLPWLLLGLVFLGSALKDGDLVPETPMQNKRNVFNVYF
VKVAWAWTFWLLLPFIGVTTYLFAKSKFLYGPTKSILAALRRLSTLLVGTAVWYVCTELF
MYIENLTGTCSTSSKLSEPHQLYATKQECHRNNGIWNGFDISGHCFLLSYCALMIVEEMA
VLEGLSIDRNSRLRVVINGLFVSLCFLTMIWVFMFLCTTVYFHDFSQKLLGALIGLAAWY
ATYRVWYLKPFSPGLPLPNIPLSSKKYSYSR
Download sequence
Identical sequences R4GIT7
XP_015152217.1.86415 XP_417378.2.86415 ENSGALP00000042033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]