SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042063 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042063
Domain Number 1 Region: 15-84
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000175
Family C-type lectin domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042063   Gene: ENSGALG00000027031   Transcript: ENSGALT00000044569
Sequence length 96
Comment pep:novel scaffold:Galgal4:AADN03010669.1:98:1138:1 gene:ENSGALG00000027031 transcript:ENSGALT00000044569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPPDIQHSLPLKDFMMRFQGLANCWIGLHREEEDTQWTWSDGTAFTNWFELRGGGRCA
YLNGDRISSSLCHLHKHWVCSRADYYVLWKQNAHPQ
Download sequence
Identical sequences A0A1L1RM19
ENSGALP00000042063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]