SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042088 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042088
Domain Number 1 Region: 177-318
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-46
Family C-type lectin domain 0.0000725
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000042088
Domain Number - Region: 95-174
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0837
Family Apolipoprotein A-I 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042088   Gene: ENSGALG00000026510   Transcript: ENSGALT00000044746
Sequence length 320
Comment pep:known_by_projection scaffold:Galgal4:JH375454.1:245:5080:1 gene:ENSGALG00000026510 transcript:ENSGALT00000044746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNGGADGACENWELTKDMLLEEQSPRKSPKRAVLSLLPSSPPRAVVLLALLLALSFVF
LMILILVNIQRVSAMREELERAQLQDKQSHTTAWHNLSEVRRALDTQLSAELQEIHSRLL
NVSREVEDVQQKMMQCRAECGKELRDRVRALEERDVLQPALQQLDELRQEQSHISTLLST
ALEETQNLTGMFCTRCPAGWQQFDKTCYYFSTEGKSWVEARAACSMLGAQLAIINSELEN
KFLANHIMEIRAFWLGLSDMQREGDWEWLDGQSLSISFWRKGEPNNVGQHGEDCATISSS
GLWNDVTCTSHEAWVCERSC
Download sequence
Identical sequences A0A1L1RQR4
XP_003643419.1.86415 ENSGALP00000042088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]