SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042120 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042120
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-29
Family beta-glycanases 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042120   Gene: ENSGALG00000026819   Transcript: ENSGALT00000042663
Sequence length 185
Comment pep:novel scaffold:Galgal4:AADN03022582.1:401:1247:1 gene:ENSGALG00000026819 transcript:ENSGALT00000042663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPQIPILRAAQAVAARPLSLYASPWTSPVWMKTNGAMTGRGTLKGTPGDKYHTAWANYF
VRFLDEYAKHNLTFWAVTAGNEPTAGEIVFYPFQCLGFSPEHQRDFIARDLGPALANSSH
RGVRLIILDDQRVMLPYWAQVVRPGVPWGCLWGGVAAFRSTEGAEKRGGGRICPWSDGMR
FYDHQ
Download sequence
Identical sequences ENSGALP00000042120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]