SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042129 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042129
Domain Number 1 Region: 803-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.26e-39
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 265-377
Classification Level Classification E-value
Superfamily Cadherin-like 2e-28
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 365-485
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 156-263
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 59-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.00075
Further Details:      
 
Domain Number 6 Region: 8-66
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000885
Family Cadherin 0.0024
Further Details:      
 
Domain Number 7 Region: 1053-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000145
Family Laminin G-like module 0.041
Further Details:      
 
Domain Number 8 Region: 730-820,1017-1066
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 9 Region: 473-575
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000343
Family Cadherin 0.0083
Further Details:      
 
Domain Number 10 Region: 1231-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000799
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 11 Region: 1191-1224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042129   Gene: ENSGALG00000028616   Transcript: ENSGALT00000044998
Sequence length 1265
Comment pep:known_by_projection scaffold:Galgal4:JH376248.1:65:10958:-1 gene:ENSGALG00000028616 transcript:ENSGALT00000044998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGAGFPFAINNSTGWIVVASELDREAVDFYSFGVEAQDQGSPPMASSASVSVTVLDVN
DNSPEFTQREYSARLNEDAAVGTSVLTVSAVDRDANSVITYQISSGNTRNRFSITSQSGG
GLLSLALPLDYKLERHYLLTVAASDGTRQDTAQVVVNVTDANTHRPVFQSSHYTVNVNED
RPVGTTVVVISATDEDTGENARITYLMEDSIPQFRIAPDTGAVTTQMELDYEDQVSYTLA
ITARDNGIPQKSDTTYLEILVSDVNDNAPQFLRDSYQGSVYEDVPAFTSVLQVSATDRDS
GLNGRVFYTFQGGDDGDGDFIIESTSGIVRTLRRLDRENVPLYALRAYAVDKGVPARRTP
VEIQVTVLDVNDNPPVFERDEFDIFVEENSPIGLVVARITATDPDEGPNAQIMYQIVEGN
IPEVFQLDIFSGELTALADLDYEAKAEYVMVVQATSAPLVSRATVHVRLRDANDNSPQLR
NFEIVFNNYITNRSGSFPGGVIGRIPARDPDVSDSLTYSFEQGNELNLVLLDPRTGDLRL
SPALDNNRPLEAVMRVSVSDGVHSATAQCTLRVTVITDEMLSNSITLRLADMSQERFLSP
LLSLFLEGVAAVLAAPRHRVVLFNIQTDTDVAAARILNVSLSVRLPASARGARFFSSEEL
QERLYLNRSLLAAISAQRVLPFDDNICLREPCENYMRCVSVLKFDSSAPFLASDTVLFRP
IHPVTGLRCRCPPGFTGDYCETEVDLCFSSPCGGNGRCRSHEGGYTCECHEDFTGEHCEL
STRRGRCALGVCRNGGTCVNLLVGGFRCECPPGHYEKPFCAMSTRSFPPRSFITFRGLRQ
RFHFTLTLTFATKERDALLLYNGRFNEKHDFVALEIVQEQIQLTFSAGETTTTVSPFVPG
GVSDGQWHRVQLHYYNKPVLGKSGLPQGPSEQKVAVVAVDDCDVGMALKFGPVLGNYSCA
AQGTQSGSKKSLDLTGPLLLGGVPTLPESFPIRSRHFVGCMRHLRVDERPVDMAAFIANN
GTVPGCPAKKTVCDAGTCHNGGTCVHEWDGFSCRCPLGFGGKTCQEEMANPQRFLGSSLV
LWSGLALPLPLPWHLGLMFRTRQPRGLLLSASAGPMATLTLQATADVAGGLQGLRLRALS
VGGLQGDGGQVEQGFRGCVQGVRVGTTGSAVMLEVATAVQVNVEGGCALPDPCDSGPCPP
HSYCSDDWDSFSCSCHPGYFGDSCVSACALDPCEHRGSCVRRAGAPHGYACECPQGYFGP
YCEHR
Download sequence
Identical sequences ENSGALP00000042129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]