SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042152 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042152
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000889
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 
Domain Number 2 Region: 63-101
Classification Level Classification E-value
Superfamily EF-hand 0.0000396
Family Polcalcin 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042152   Gene: ENSGALG00000027028   Transcript: ENSGALT00000043902
Sequence length 127
Comment pep:known_by_projection chromosome:Galgal4:1:13821811:13823862:-1 gene:ENSGALG00000027028 transcript:ENSGALT00000043902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGEQQSREYLERHGLPALLHRLAALLLYHRPERPRQFLIQVLEAVRAARRGEAAMPGV
LDEADVEAVFRMLDAAGRGFVTGRQCRAALKTLGLSTAELRVGDEEEIRLPGFKEEVMKT
LLEGWTV
Download sequence
Identical sequences A0A1L1S0V5
XP_001232475.1.86415 XP_004934810.1.86415 ENSGALP00000042152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]