SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042156 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042156
Domain Number 1 Region: 30-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042156   Gene: ENSGALG00000025886   Transcript: ENSGALT00000044454
Sequence length 269
Comment pep:known_by_projection chromosome:Galgal4:12:6644909:6670629:-1 gene:ENSGALG00000025886 transcript:ENSGALT00000044454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAATAPGPDEPRTAAPGRDGGGPRGYTGQCSHVHPPQLGTLQIIHGNGTAVGTVIAFQC
AAEHQLEGPGIITCIWKGNGTQWTAEVPSCKPISKYETFGFKVAVIASIVSCAIILLMSM
AFLTCCLIKCVKKSERRRTERDMQLWYQLRTEELENMHAAYFGYKGRNNNNNKKLRNKSV
FDDMANVAYDNQGFYRFQEEWTRDTAALGRCKASEQLPKLSSSSSSSGTPGRHTGPGHSS
AQHTVNSVHVVEVYGHTERYNKARCQIPG
Download sequence
Identical sequences R4GJ53
ENSGALP00000042156 XP_414330.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]