SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042257 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042257
Domain Number 1 Region: 31-228
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.32e-50
Family Prokaryotic proteases 0.000000343
Further Details:      
 
Domain Number 2 Region: 244-331
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-21
Family HtrA-like serine proteases 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042257   Gene: ENSGALG00000027539   Transcript: ENSGALT00000042823
Sequence length 340
Comment pep:known_by_projection scaffold:Galgal4:JH375171.1:167951:174912:-1 gene:ENSGALG00000027539 transcript:ENSGALT00000042823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPAALASLIPAGPLRVSTPSCDLCPPCRHPFSGREVPISNGSGFLVSPDGLIVTNAHV
VANRRRVRVKLASGEQYDAVVQDVDQVADIATIRIKPKVRAAAREGSLPRLPSAYTVPLF
QHPLPTLPLGRSSEVRQGEFVVAMGSPFALQNTITSGIVSSAQRGSRELGLAASDMEYIQ
TDAAIDFGNSGGPLVNLDGEVIGVNTMKVTSGISFAIPSDRLRKFLQKEEERKSSWFGNA
ETKRRYIGVMMLTLTPSILAELKLRDPSFPDVSYGVLIHKVIIGSPAHQAGLKAGDVVLE
INGQATRRAEDVYEAVRTQQSLALLVRRSYDTLLEPGTQD
Download sequence
Identical sequences ENSGALP00000042257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]