SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042407 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042407
Domain Number 1 Region: 147-268
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-34
Family C-type lectin domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042407   Gene: ENSGALG00000027532   Transcript: ENSGALT00000044792
Sequence length 271
Comment pep:known chromosome:Galgal4:3:93337088:93359378:1 gene:ENSGALG00000027532 transcript:ENSGALT00000044792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRDLVFLVTLISLAFLSLLRSGYPQHIAEESCSVQILVPGLKGEAGEKGEKGAPGRPGR
VGPPGEKGEMGDKGQKGSMGRHGKIGPIGSKGEKGDNGDIGPPGPNGDPGIPCECSQLRK
AIGEMDIQVAQLTTELKFIKNAVAGVRETDNKIYLLVKEEKRYKEAQLYCHGRGGTLSMP
KDENANNLIASYINQAGLTRVFIGINDLEKEGNFVYSDRSPMQTFNKWRSGEPNNAYDEE
DCVEMVASGGWNDVACHITMYFVCEFDKENV
Download sequence
Identical sequences A0A1D5P9I6
ENSGALP00000026396 9031.ENSGALP00000026396 ENSGALP00000042407 XP_005012602.1.99704 XP_015140329.1.86415 XP_021247779.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]