SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042556 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042556
Domain Number 1 Region: 261-287,328-573
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-71
Family Nuclear receptor ligand-binding domain 0.00000000147
Further Details:      
 
Domain Number 2 Region: 208-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-29
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042556   Gene: ENSGALG00000012973   Transcript: ENSGALT00000043505
Sequence length 621
Comment pep:known chromosome:Galgal4:3:48276571:48431328:1 gene:ENSGALG00000012973 transcript:ENSGALT00000043505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTFWDKCGLPAADLAVDSKSRYVPCSLPLAMTMTLHTKASGVTLLHQIQGTELETLSR
PQLKIPLERSLSDMYVESNKTGVFNYPEGATYDFGTTAPVYGSTTLSYAPTSESFGSSSL
AGFHSLNNVPPSPVVFLQTAPQLSPFIHHHSQQVPYYLENEQGSFGMREAAPPAFYRPSS
DNRRHSIRERMSSTNEKGSLSMESTKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQ
GHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMMKQKRQREEQ
DSRNGEASSTELRAPTLWTSPLVVKHNKKNSPALSLTAEQMVSALLEAEPPIVYSEYDPN
RPFNEASMMTLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWR
SMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATAARFRMMNLQGEEFVCLKSIILL
NSGVYTFLSSTLKSLEERDYIHRVLDKITDTLIHLMAKSGLSLQQQHRRLAQLLLILSHI
RHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPAARSAAPMEEENRNQLTTAPAS
SHSLQSFYINSKEEESMQNTI
Download sequence
Identical sequences XP_015139536.1.86415 ENSGALP00000042556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]