SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042675 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042675
Domain Number 1 Region: 75-115
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000719
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 2 Region: 34-73
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042675   Gene: ENSGALG00000028665   Transcript: ENSGALT00000043615
Sequence length 569
Comment pep:novel scaffold:Galgal4:JH375182.1:401984:413965:1 gene:ENSGALG00000028665 transcript:ENSGALT00000043615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSYLKVMIIWNIICVSLVILSLSPVQEVASQDLWSCTGRCGEGYSREHVCHCDYSCQHY
KECCPDFNKVCTGAVSCKGRCFEVYQRGRECDCDVDCKQYGKCCPDYDEHCEELHTENPV
PKTPPPNKSTSKRSSTDEEKKPEEDIGTATSPPPTTKQPDTRAPSKAITTIPFTQKHTLQ
PTTSITTKPKTTTQKAEETTPEGTEAPTTPKDEEITPAATEAPTTPNPEDMTPEATEAPI
TPKAEETTLEATEAPTTPHPEDTTPEATEAPTTPKAEETTPEATEALTTSKAEETTLEAT
EAPTAPKAEETTPEATEAPITPKAEETTLEATEAPATPNPEDMTPEATEAPLTPKAEETT
PEATEAPTTPNPEDMTPEATEAPTTPKAEETTLEATEAPTTPKAEETTPEATEAPITPKA
EETTLEATEAPTTPNPEDMTLEATEAPITPKAEETTPEATEALTTSKAEETTLEATEAPT
TPKAEETTPEATEAPTTPKAEDMTPEATEAPTTPKAEETTLEATEAPTTPHPEDTTPEGT
EAPTTPKAEETTPEATEALTTSKGEETTL
Download sequence
Identical sequences ENSGALP00000042675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]