SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042707 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042707
Domain Number 1 Region: 45-240
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.66e-69
Family Eukaryotic proteases 0.00000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042707   Gene: ENSGALG00000025752   Transcript: ENSGALT00000045359
Sequence length 242
Comment pep:novel chromosome:Galgal4:1:77712776:77715424:1 gene:ENSGALG00000025752 transcript:ENSGALT00000045359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLVLVAFVGVAEPEPMREMFQSVTGPRLWRLQLCKELQLQECRPYQVSLNSGYHFCGG
SLISSQWVLSAAHCYKSSIQVKLGEYNLAAQDGSEQTISSSKVIRHSGYNSNTLNNDIML
IKLSKAATLNSYVNTVPLPTSCVTAGTTCLISGWGYTLSRVEQRAHERCFFQALKFYQLC
HHRCLNRGKDSCQGDSGGPVVCNGQLQGIVSWGFGCAQKGYPGVYTKVCNYVSWIKTTMS
SN
Download sequence
Identical sequences ENSGALP00000042707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]