SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042908 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042908
Domain Number 1 Region: 670-768,797-861
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000108
Family Mannose 6-phosphate receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 102-132,286-425
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000523
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000042908
Domain Number - Region: 607-655
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00102
Family TNF receptor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042908   Gene: ENSGALG00000026986   Transcript: ENSGALT00000043678
Sequence length 1017
Comment pep:known_by_projection chromosome:Galgal4:26:1129226:1136672:1 gene:ENSGALG00000026986 transcript:ENSGALT00000043678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGVVLPNPAPSSLVPKCVPQHAGCCGIGTSQKSPHIPTAAAELAGGPIPVGSQPSTRSL
LQSEYHYEYTACDSAGARWRVAVPHTPGLCTGLPDPVKGTECSFSCKAGEFLDMKAQACK
PCAEGTYSLGTGVRFDEWDELPHGFANVATNLELDDGFSDVVENCTTSTWVPLGDYIASN
TDECTATLMYAVSLKQSGTVSFEYIYPDSSIVFEFFVQNDQCQPTVEESRWMRTTEKGWE
FHSVELSRGNNVLYWRTTAFSVWSKVPKPVLVRNIGITGVAYTSECFPCKPGTFAAAAGS
SSCQLCPANSFSSKGATACQPCEPTAYAEPGSASCKMRPPCTDKDYFYTHTACDANGETQ
LMFKWAEPKICSEALPRAAQLPPSGLKTRCPPCNPGFYKSNSSACEPCPYGSYSNGSGCV
RCPAGTEPVLGLEYKWWNVLPPNMETTVLSGINFEYKGMAGWEVAGDYIYTAAGASDNDF
MILTLLVPGFSPPQPALEDGDSKEVARITFVFETVCSVSCELYFMVGINSRTNTPVETWT
GPRGKQSYTYVVEKNATTSFTWAFQRTRYREAGRRYTSDVAKLYSVNVTNVLGVASFCRR
CAATGGLCAPCPGHALDHSTGACQPCPPGTFLRGHPPDGPPACQPCGPGTRSNQVRSLCY
SDCTFSLALPGQTLHYDFSALSASTAFTSGPSFTSKGLKYFHHFNISLCGNHGRKAASCT
DNVTDARLPDEGGSGRVVTSHVCQAIVVPSDVVGHRAAVSSQPVSLADRLLGVTVSSALD
GVAAPPELFPPASPELPDVVFFFRSGEVTQSCAGGRATTIRLRCDPLRPGTGSLAVPSKC
PEGTCDGCTFHLLWATAEGCPRCSANHFRAIVGACQGGVQRTTYVWKEPRLCHGGQRLPA
PRVRPCRSAEFWLKVGVSVGTCVAVLLAALAAYFWKKNQKLEYKYSRLVLNAAAKESELP
APDSCAIMEGEDGEDELIFTSKKSLLGKIRCLATKRTPDGFDSVPLKPSSGGTDLEL
Download sequence
Identical sequences ENSGALP00000042908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]