SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042941 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042941
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-21
Family C-type lectin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042941   Gene: ENSGALG00000028962   Transcript: ENSGALT00000044123
Sequence length 139
Comment pep:novel chromosome:Galgal4:16:223503:225021:1 gene:ENSGALG00000028962 transcript:ENSGALT00000044123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQRGAKDANLSLRCIKDKLLPIAGTVLVAALLIAVIALAAQKPPPVPPLPHSRPHLPG
CPNDGIGVGLQCFYFVEDAADWDGGQRFCLSRGAQLAAVGTPQELGFVLRYGRSVQYWIG
LRRDRSGPWMWANGSLFNN
Download sequence
Identical sequences ENSGALP00000042941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]