SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043012 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043012
Domain Number 1 Region: 199-330
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-39
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 2 Region: 475-620
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-38
Family C-type lectin domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 340-476
Classification Level Classification E-value
Superfamily C-type lectin-like 3.42e-34
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 4 Region: 68-185
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-31
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 640-719
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-16
Family C-type lectin domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043012   Gene: ENSGALG00000027765   Transcript: ENSGALT00000045580
Sequence length 723
Comment pep:novel chromosome:Galgal4:2:19359572:19376473:-1 gene:ENSGALG00000027765 transcript:ENSGALT00000045580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRLLIFLCLVRGMLQLQSLVPAAEGCLSAEGKEEESLEPGSAQPCPDSPAADNTERF
WTEDASTGVLYQINSESALTWHQARKSCQEQNAELLSITEIHEQEYVGELIKKFSFALWI
GLNTLNFNSGWQWAGGSPFRYLNWAPGSPFPAPGKICGTMNPRQNAKWENQACNQRFGYI
CKKRKINSKFDNITREEMTPIKCTEGWLPYASHCYSIQRESKAWKDALTSCKRQGGDLAS
VHSITEYSFLVSQLGYMPTEELWLGLNDLKTHFYFEWSDGTPVTFTTWQRRHPTYRNGLE
DCVVMKGQDGYWATDVCDKQFGYICKKKPSSRSPEEKIKDPGCQEGWKRYGFHCYLVGSA
LATFSDANKTCEQSKAYLATVETRNEQAFLISLTGLRSGKYFWLGLSDTEKRGMFKWTSG
ETPSFTHWNSAMPGKEQGCVAMGTGVSAGLWDVISCQETANFLCKQQAVEVPPPAPPAQV
PAAACAQGWDGAPHADSCFKFFVRDKNLKKNWFEAEEFCREIGGNLVTINSKEDQVLIWQ
LALEKGLQTQGFWMGLFLLNPDEGFTWIDGSPVIYENWDEDEPNNDKGIEHCVMFNRSPQ
MRWNDLYCEYLLNWICETKKGTLLKPEPNNKYEYQAVQTADGWIIYEDKQYYFSRERVPM
EEARRICQRNFADLVVIEDESERQFIWKYINRKRSGVFFQEESYFIGLFVSSDQKLRWVK
EEH
Download sequence
Identical sequences ENSGALP00000043012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]