SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043031 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043031
Domain Number 1 Region: 77-197
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000811
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043031   Gene: ENSGALG00000028915   Transcript: ENSGALT00000043724
Sequence length 218
Comment pep:novel scaffold:Galgal4:AADN03025770.1:21:3649:-1 gene:ENSGALG00000028915 transcript:ENSGALT00000043724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRLLPAGSEQQVLSAHGGAATMPSAFQLQCHLVLILLAASKGDTRYLEVRDAGEDEPF
LLLSEDLKRELSAGHIYRRSLRCIDMLSIEGQFTFTADQPQLHCATFFIGEPEELLTIEY
DFVNIDCQGGDFLKVFDGWILKGEKFPSSLDHPLPTSQRYTDFCESGAVQRSIRSSQNVA
MIFFRIHQPGNGFTITVKKSANLFRKSDFVLPSGLQLW
Download sequence
Identical sequences ENSGALP00000043031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]