SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043060 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043060
Domain Number 1 Region: 88-254
Classification Level Classification E-value
Superfamily L domain-like 3.79e-29
Family Ngr ectodomain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043060   Gene: ENSGALG00000026736   Transcript: ENSGALT00000045074
Sequence length 294
Comment pep:known chromosome:Galgal4:12:3424003:3438509:1 gene:ENSGALG00000026736 transcript:ENSGALT00000045074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLQAAFFLVAFVPLVKPAPPIQQDSPKFYEYVDADFATGSLIQQDYEMLPKDTIKDGT
NVSLDTALRLQADDSELSARPTKDTNLPTCLLCVCLSGSVYCEEIDIEAVPPLPKETAYL
YARFNKIKRIAVSDFADITTLRRIDFSGNMIEEIEDGAFSKLLLLEELSLAENRLVKLPV
LPPKLTTFNANQNRIKSRGIKNNAFKKLTNLAYLYLGHNALESVPLNLPESLRILHLQHN
NITTINDDTFCKSNNTRYIRTRMDEIRMEGNPILLAKHVNAFSCLRTLPVGTYY
Download sequence
Identical sequences Q9W6H0
NP_989540.1.86415 ENSGALP00000007525 9031.ENSGALP00000007525 ENSGALP00000043060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]