SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043075 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043075
Domain Number 1 Region: 276-324
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043075   Gene: ENSGALG00000027109   Transcript: ENSGALT00000045656
Sequence length 330
Comment pep:known_by_projection chromosome:Galgal4:4:84441720:84468575:1 gene:ENSGALG00000027109 transcript:ENSGALT00000045656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLMFVYCSCKVIWTLLVTILGYASSLPLGDDSICTAEELAKYSIIFTGKWSQTAFPKQ
YPLYRPPAQWSSMLGVTHSSDYSMWKKNEYASNGVRDFAEKGEAWVLMKEIEEAGEKIQS
VHGIFSAPAISSGTGQTSTELQVHSRHPLVSFVVQIVPSPDWFVGIDSLNLCEGDHWMEK
ISVDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITCSSPSHPANSFYYPKLKILPPIAQV
TMVKLKKNQLGFPIPHLNQPAKSNEILDTFSETPLDCEVSQWSSWGLCRGPCRKMGTKIR
TRFVVLHPANDGTPCPSLEEETECEPDNCV
Download sequence
Identical sequences ENSGALP00000043075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]