SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043085 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043085
Domain Number 1 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 4.83e-20
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043085   Gene: ENSGALG00000028562   Transcript: ENSGALT00000044394
Sequence length 138
Comment pep:novel scaffold:Galgal4:AADN03015919.1:1045:1648:1 gene:ENSGALG00000028562 transcript:ENSGALT00000044394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASMAVNLILGWWLVAASRAQQLQRPSLSLHPSQGVSLGDPVTLRCHLPRLSAWVQLYQE
GGWFYSKGKKKEQDAAEFLFVSTFREHASRYWCQYWVFESAEVSVESDPVELVLTGEDTG
DSKWLWLLPTGPCPTAVP
Download sequence
Identical sequences ENSGALP00000043085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]