SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043257 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043257
Domain Number 1 Region: 28-57,175-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-58
Family G proteins 0.0000000251
Further Details:      
 
Domain Number 2 Region: 57-177
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.22e-41
Family Transducin (alpha subunit), insertion domain 0.000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043257   Gene: ENSGALG00000028697   Transcript: ENSGALT00000045180
Sequence length 350
Comment pep:known chromosome:Galgal4:12:3189383:3192093:1 gene:ENSGALG00000028697 transcript:ENSGALT00000045180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLE
ECLEFIAIIYSNTLQSMLAIVRAMTTLNIQYGDSARQDDARKLLHLSDTIEEGTMPKEMS
DIIGRLWKDAGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGI
IETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMH
ESLHLFNSICNHRYFATTSIVLFLNKKDVFLEKIKKAHLSICFPDYDGPNTYDDAGNYIK
LQFLELNMRRDVKEIYSHMTCATDTENVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences Q9DG28
ENSGALP00000043257 NP_990022.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]