SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043279 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043279
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-25
Family C-type lectin domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043279   Gene: ENSGALG00000026352   Transcript: ENSGALT00000042996
Sequence length 116
Comment pep:novel scaffold:Galgal4:JH375196.1:1618:5735:1 gene:ENSGALG00000026352 transcript:ENSGALT00000042996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYFSKEENDWNSSREHCSAHGASLATIGSAEEMDFMMRFQGPANCWIGLHREEEDALWT
WSNVTAFTNWFELRGGGRCAYLNGDRISSSLCHLHKHWVCSRADHYVLWKQKVHPQ
Download sequence
Identical sequences ENSGALP00000043279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]