SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043318 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043318
Domain Number 1 Region: 293-422
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-42
Family C-type lectin domain 0.00015
Further Details:      
 
Domain Number 2 Region: 722-853
Classification Level Classification E-value
Superfamily C-type lectin-like 7.04e-34
Family C-type lectin domain 0.00056
Further Details:      
 
Domain Number 3 Region: 432-566
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-33
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 4 Region: 96-276
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-33
Family C-type lectin domain 0.00091
Further Details:      
 
Domain Number 5 Region: 575-709
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-32
Family C-type lectin domain 0.0000538
Further Details:      
 
Domain Number 6 Region: 2-86
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000379
Family Cysteine rich domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043318   Gene: ENSGALG00000028357   Transcript: ENSGALT00000046122
Sequence length 884
Comment pep:novel chromosome:Galgal4:2:19322416:19342085:-1 gene:ENSGALG00000028357 transcript:ENSGALT00000046122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAFAQCLGVRYKQDQAKISLYPCNKESEFQKWGCINSTLVIHGENLFLSIGKRKKDNI
VLDSGSGTMNKWKIFGTTDDLCSQDYKDLFTLLGNSHGAPCTFPFQLSGKWYAGCTDAGR
LDGLLWCATTPSFDTDHLYGFCPTGSSDNDKFWSMDPLTGTFYQINFQSALTWHQARHSC
KQQNAELLSVTEIHEQMYLRDLIDSNRSPLWIGLNSLNLHSGWQWSGGTPFRYFNWAPGS
PSPEPDKLCAVLNPRTDAKWENRPCEQKVGYICKKENSTLGPSSLPLEDAEPVKCPEGWL
PYAGHCYVIHREPRAWKDALMSCNESNGNLASIHNSEEHAFILSQLGYKATDDLWIGMND
FSTQMYFEWSDETPVTYTKWLPGEPTHAVSGQEDCVVMAGEDGYWADSDCDRKLGYICRR
EPLQGVSGTVKTDPACTRGWTRHGSYCYLVGRAPVTFSEAVKTCERIGGYLTTIEDRYEQ
AYLTSFVGLSSEKCFWIGLSNTEEQEIFKWETGEGVFYTNWNSAMPGKEVGCVALRTGSA
AGLWDVQNCELKAKFLCKKPAEKITRPFAPGKHSDFKCPLGWNTSNSTNSCFRTFVREKN
HKKTWFEARDFCREIGGDLAAINSEEEQRVIEDLITKKPPSSQLFWIGLQRLDPDGGLSW
SDRSPVSYMKTTPFYDDPLENCGAISKEHSISWINMHCEYSLDWICEIKKGTLLKPEPVS
PSAMYEVTEDGWIIKGDKQYFFSTESTSMEKARTFCKNHRGDLAIIGDNNQRIFLWKYIL
KNGKLHSYLIGLILNADRQFRWVDGSTLHYAPWAQGEPNFASAQEHCVVLDKKYGLWNDV
SCGHSHGFICERHGSFVNATLSPAVTSPPGGCPEDWLLFENQVW
Download sequence
Identical sequences ENSGALP00000043318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]