SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043333 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043333
Domain Number 1 Region: 12-186
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-61
Family Eukaryotic proteases 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043333   Gene: ENSGALG00000026134   Transcript: ENSGALT00000043388
Sequence length 187
Comment pep:novel chromosome:Galgal4:4:51069659:51076359:-1 gene:ENSGALG00000026134 transcript:ENSGALT00000043388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPHKWTATFGALLKPPTLKRSVKTIIIHEMYRYPEHDYDIALVKLSKQVEFTSNIHRV
CLPEPSQTFPYNIYAVITGWGALTNDGPTPNALQEATVKLIDSDTCNRKEVYDGDITPRM
LCAGYLEGGVDACQGDSGGPLVTPDSRLMWYLVGIVSWGDECAKPNKPGVYTRVTYFRDW
ITSKTGI
Download sequence
Identical sequences R4GM81
ENSGALP00000043333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]