SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043376 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043376
Domain Number 1 Region: 28-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-29
Family Nuclear receptor 0.00012
Further Details:      
 
Domain Number 2 Region: 127-226
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.19e-17
Family Nuclear receptor ligand-binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043376   Gene: ENSGALG00000028624   Transcript: ENSGALT00000044089
Sequence length 249
Comment pep:known scaffold:Galgal4:JH375216.1:3231:5454:1 gene:ENSGALG00000028624 transcript:ENSGALT00000044089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSSPSDPDSPGAQRCPNVTDVTEEELKVCAVCGDRATGYHFHVMSCEGCKGFFRRSIL
KGVHFTCPFTRSCPITKAKRRQCQACRLQKCLDVGMRKDMIMSEEALGRRRALRLQRRLA
QAQPGGLTAEQQELISILIAAHKRTFDSSFSQFQHYQPAVRLCIPGPCSQSPPGPGVPSA
SLSPQLDCLDEDVLPDVFSILPHFADLSTFMIQQVIKFAKEIPAFRWARWWGGHPPPQLN
AIPQPNSVP
Download sequence
Identical sequences ENSGALP00000043376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]