SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000043420 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000043420
Domain Number 1 Region: 79-378
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.33e-90
Family Nuclear receptor ligand-binding domain 0.00000000699
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000163
Family Nuclear receptor 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000043420   Gene: ENSGALG00000026166   Transcript: ENSGALT00000046121
Sequence length 383
Comment pep:known scaffold:Galgal4:JH375554.1:116239:126586:1 gene:ENSGALG00000026166 transcript:ENSGALT00000046121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVGRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKRE
MILKRKEEEALKESLKPKLSEEQQKVIDTLLEAHHKTFDTTYSDFNKFRPPVRSKFSSRM
ATHSSSVVSQDFSSEDSNDVFGSDAFAAFPEPMEPQMFSNLDLSEESDESPSMNIELPHL
PMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEVIMLRSNQSFTMEDM
SWTCGSNDFKYKVSDVTQAGHSMDLLEPLVKFQVGLKKLNLHEEEHVLLMAICILSPDRP
GVQDTSLVESIQDRLSDILQTYIRCRHPPPGSRLLYAKMIQKLADLRSLNEEHSKQYRCL
SFQPEHSMQLTPLVLEVFGNEIS
Download sequence
Identical sequences A0A1D5NUY7
ENSGALP00000043420 XP_015128093.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]