SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000083 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000083
Domain Number 1 Region: 417-582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-58
Family SPRY domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 17-57,145-177
Classification Level Classification E-value
Superfamily RING/U-box 5.79e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 211-269
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-17
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000083   Gene: ENSGALG00000019835   Transcript: ENSGALT00000000084
Sequence length 589
Comment pep:known chromosome:Galgal4:16:144211:148883:-1 gene:ENSGALG00000019835 transcript:ENSGALT00000000084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVGDDGASSGRLNPVETLQEEAICAICLDYFVEPVSIGCGHNFCRVCIAQLWGGGEAE
VEESGGAAALEEEEEELEEEEEDELGEEELDELWDGVVQGELYFGDDDYDEDVMEEDVEE
EEEEEDEAQSPPPPVLPARPRRLQTFTCPQCRKTFFQRNFRPNLQLANMVQIIRQLHPHP
QRLAPPAGPSASGGPGGNPGILVATGGRGCPNLCEKHQEPLKLFCEVDEQAICVVCRESR
SHKHHSVVPLEEVVQDYKYKLQSHLEPLKKKLDAVLKQKSNEQEKITELREKMKLEIKEF
ESDFELLHQFLIGEHVLLLHQLEERYESLLARQSSNISQLEEQSAALSRLITEAEDKSKQ
DGLQLLKDIKGTFIRCENIKFQEPEMVLVDVGKKYRNYFLQDVVMRKMEKAFSKVPQADI
TLDPDTAHPRLSLSLDRRSVKLGERRQELPNNPKRFDSDYCVLGSQGFTTGRHYWEVEVG
GKKGWAVGAARETARRKEKTMGPHQKREIWCVGTNGKKYQALTAMEQMALSPSERPRRFG
VYLDYERGQLCFYNAESMTHIHTFNASFHERIFPFFRILAKGTRIKICT
Download sequence
Identical sequences Q5EVY2
NP_001025843.1.86415 ENSGALP00000000083 9031.ENSGALP00000000083 ENSGALP00000000083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]