SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000187 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000187
Domain Number 1 Region: 32-170
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-28
Family C-type lectin domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000187   Gene: ENSGALG00000000136   Transcript: ENSGALT00000000188
Sequence length 175
Comment pep:known chromosome:Galgal4:16:108301:110805:1 gene:ENSGALG00000000136 transcript:ENSGALT00000000188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVFQKTTPPPSAARHCPETNGRNGTELCKNTSIEQYFCQSKLSSSAAPAACLLCPQFWR
LLGDRCYGLSTEKENWTQAKMKCENLQSQLAVLRKKAEKDHLQKMAGAEPVWIGLEVSTN
QLKWVDNSSYNSTEFDNLPVMENGCGTFKNTKVEGDVCSGEHKWVCQKEPLRLYP
Download sequence
Identical sequences ENSGALP00000000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]