SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000360 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000360
Domain Number 1 Region: 28-121
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.19e-22
Family Hormone receptor domain 0.00031
Further Details:      
 
Domain Number 2 Region: 135-407
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000558
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000360   Gene: ENSGALG00000000274   Transcript: ENSGALT00000000361
Sequence length 423
Comment pep:known chromosome:Galgal4:27:1661386:1669153:-1 gene:ENSGALG00000000274 transcript:ENSGALT00000000361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCPWLNPNSCVLLLLLALPMLQVRATHPDCSVILYFQEREDECLEAIRSESQTQSPGGQ
RGCRTAWDGVSCWPAMPVGQSHAVACPDVPHIFKKSKALIHRNCTEVGWSPPSPPYYSAC
ELEAVGSSNNTEAKRGYFITMKVLYTCGYSTSLAALFLAIGIFSCFRKLHCTRNSIHIHF
FTSFILRGAAVLIKDAVLFSDESVDHCTMSTVKCKASIAFVQYSVLANFYWLLVEGMYLQ
TLLLLTFTSDRSYIWWYILIGWGVPMLTVCVWVVTRLQYDDHGCWDDYSSPYWWVIKAPI
LLAIFVNFLIFLNVTRMLAQKIRSPDISKNYKQQYMRLTKSTLLLIPLFGVHYVVFAFFP
EHIGVDARLYFELVLGSYQGFLVALLYCFLNGEVQSEIKRNWGKWQSTMESNVFNMATQD
FTA
Download sequence
Identical sequences F1NKQ1
ENSGALP00000000360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]