SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000502 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000502
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.83e-29
Family Hormone receptor domain 0.0000464
Further Details:      
 
Domain Number 2 Region: 106-391
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000861
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000502   Gene: ENSGALG00000000371   Transcript: ENSGALT00000000503
Sequence length 420
Comment pep:known chromosome:Galgal4:27:2226991:2253136:1 gene:ENSGALG00000000371 transcript:ENSGALT00000000503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGPRPALLLLLFLLQAFLLWDSPVAASIQEQYCESLLPTTNHTGPQCNASVDLIGTCW
PRSAVGQLVARPCPEYFYGVRYNTTNNGYRECLANGSWAARVNYSQCQEILSEEKRSKLH
YHIAVIINYLGHCVSLGALLVAFVLFMRLRSIRCLRNIIHWNLITAFILRNATWFVVQLT
MNPEVHESNVVWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIG
WCIPFPIIVAWAIGKLYYDNEKCWFGKRAGVYTDYIYQGPMILVLLINFIFLFNIVRILM
TKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISRIVFIYFNSFLESFQ
GFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSSAV
Download sequence
Identical sequences F1NS14
9031.ENSGALP00000000502 ENSGALP00000000502 ENSGALP00000000502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]