SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000581 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000581
Domain Number 1 Region: 357-409,438-641
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-40
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 68-184
Classification Level Classification E-value
Superfamily ARID-like 1.57e-30
Family ARID domain 0.001
Further Details:      
 
Domain Number 3 Region: 295-353
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.73e-16
Family PHD domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1140-1212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000509
Family PHD domain 0.016
Further Details:      
 
Domain Number 5 Region: 1470-1532
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000494
Family PHD domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000581   Gene: ENSGALG00000000427   Transcript: ENSGALT00000000582
Sequence length 1535
Comment pep:known chromosome:Galgal4:26:517962:560066:1 gene:ENSGALG00000000427 transcript:ENSGALT00000000582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNVPLFTGMLEKGWRKGNSQRLGKIWLHLKKIMKKWAQTRWMEKMKAKNTECSQSELQD
WQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILD
LFQLNRLVAEEGGFDVVCKERKWTKIATRMGFAPGKAVGSHIRAHYERILYPYNLFQSGA
SLLCLQKPDLTSDTKDKEYKPHDIPQRQSVQPSESCPPARRAKRLRAEATNIKTESDSPE
VRTHNLRRRMGCAPPKCENEKETYSAVKLAEKREHAGEQERDKAKARSKKPTSAVDLYVC
LLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPQCLAQECNKPQEAFGFEQ
AARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASK
EFGSGFPVRDGKFKVRPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMC
FSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGYAAEQLEDVMKKLAPELFESQPDLLHQL
VTIMNPNTLMAHGVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGR
QCIEHYRLLSRYCVFSHDEMICKMASKADILDVVVASTVQKDMAIMIDDEKMLREKVQKL
GVTDSERVAFELFPDDERQCYKCKTTCFMSAVYCPCKPGLLVCLYHVEDLCSCPTYQYKL
GYRYTLEELYPMMNALKMRAESYNEWASNVNEALEAKISNKRSLISFKALIEESELKKFP
DNDLLRHLRLVTQDADKCASVAQQLLNGKRQTRYRSGGGKCPNQLTVNELRLFVRQLYAL
PCVLSQTPLLKDLLDRVEAFQQQSQKLLSEEMPSAAELQELLDVSFDFDVDLPQLAELRV
RLEQARWLEDVQMASAEQNSLTLDDMRRLIDSGVGLAPYPAVEKAMAKLQELLTVSEHWD
DKARNLIKARPRQSLSSLVVAVKEIEEIPAYLPSGAALKDAVQKAQDWLQEVEALQVGGR
VPVLDTLVELVTRGRSIPVHLDYLPRLESLVAEVQAWKECAANTFLCENSPYSLLEVLCP
RCDIGTLGLKRKQKKLKEPMPSGKKRSTKLESLSDLERALSESKDTASAMATLGEARLKE
MEALRSLRAANEGKVLCSEEDAELKVCVCQKEPAAPMIQCELCRGFFHTGCVSVPHALQG
PRVWLCPQCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTVNWQHRAQQMLYS
GNLKLLQDKVGSGLLYNRWQSTAGPLPETNKVSQTIGAMSFSMPHDWDNRTIYLHSPFST
GQQCIPLHVVSTELDELMMEAQLLQVSLPEIQELYQILFTKQSPSLQAEQKPSVGPSNEK
SECCRGKKDGMSYMERKLKRRFERESFCDEKRARVRKMRTPKKKKLKLSHTKDVSSSSRM
ERERERLLEAQRSSESHLVPSDTSFSEQEDSEDEDAICPAVTCLQPEGEEVDWVQCDGSC
NQWFHQVCVGISPEMAEKEDYICASCAGKGSPYRK
Download sequence
Identical sequences ENSGALP00000000581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]