SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000000626 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000000626
Domain Number 1 Region: 282-416
Classification Level Classification E-value
Superfamily C-type lectin-like 8.07e-43
Family C-type lectin domain 0.000098
Further Details:      
 
Domain Number 2 Region: 144-277
Classification Level Classification E-value
Superfamily C-type lectin-like 2.65e-36
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 3 Region: 732-863
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-34
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 4 Region: 873-1021
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-33
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 5 Region: 427-561
Classification Level Classification E-value
Superfamily C-type lectin-like 5.67e-32
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1030-1159
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-30
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 7 Region: 576-720
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-29
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 8 Region: 1175-1307
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-26
Family C-type lectin domain 0.0081
Further Details:      
 
Domain Number 9 Region: 81-139
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 10 Region: 2-81
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000116
Family Cysteine rich domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000000626   Gene: ENSGALG00000000461   Transcript: ENSGALT00000000627
Sequence length 1389
Comment pep:known_by_projection chromosome:Galgal4:27:2412671:2426010:1 gene:ENSGALG00000000461 transcript:ENSGALT00000000627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCLGVSWHGGNATAGLHPLATYECDRESVNMRWSCRGLGEQLSQHLGARPANTSLDRGD
QARSSQWRTYGTEEDLCSVPYSEIYTIQGNSHGKPCTIPFKYDNQWFHECTSTGREDGHL
WCATTQDYGKDERWGFCPIKSNDCETFWDKDHLTNSCYQFNFQSTLSWREAWNSCEQQGA
NLLSITEIHEQTYINGLLTGYSSTLWIGLNDLDINGGWQWSDNSPLKYLNWESDQPDNPS
EENCGVIRTESSGGWQNRDCGIALPYVCKKKPNATTDPFLTDSWSEVKVDCEPSWQSFQS
NCYRLVGEKKSWQDAKKTCLRSGGDLVSIHTLSELEFVTKQVKQDVEELWIGLNDLKLQM
NFEWSDGTPVRFTYWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKPGRVS
QEKEEDDHGCRKGWKWHSPSCFWLGEDRVTYSDARKMCSDYGSTLVTITNRFEQAYVSSL
IYGWDGEYFWTALQDINETGAFRWLSGDEVMYTHWNRDQPGYNKGGCVALATGSSMGLWE
VKNCSTFKAKYICRQNLGTPVNPELPSAYPTPSLTGTCPLGWSADPKLRHCYKVFNFDKL
QEKKTWIAAQEFCRELGAQLLSLGSYEEEHFVANTLNKIFGESEPEIHEQHWFWIGLNRR
DPAGDRSWRWSDGLGFFYHNFDRSNYDDDDIRNCAVLDLASLQWMPMQCEAQLDWICKLP
KGTDVKEPEITTQGSKEWVKYQEAEYKFFEHHSTWMQAQRICSWFQAELVSVHSESELHF
LGQNLKKFSRGQEQHWWIGLHTYENDGRFKWSDGSLLNFVSWAPGKPRPINKDKKCVYMT
ASREDWGDQKCPTALPYICKRSNATAVKPSIPPLPAPASGGCPRGWVPFLSKCFSFNGHD
KADIVKWPEAKQACESQGAVLATISSPLEQAFITSMLLNISFDLWIGLHDAKKEFQWVEG
EPLRHVSWAPGEPSECSSSSPGDKPTNCVVVWHGSPPHFTGRWDDRSCVEEKHGYICQRK
IDPSLSPAQTPYPPSPTGTLFYHNSTYRILQKPLRWHEALLLCETLNATLATIPDPYSQA
FLTQAVSSLRAPLWIGLANNEGGRSYSWLSEESLFYTNWQDGEPQQAAGCAYMDVDGSWR
TAGCDTKLQGGICQLQSGPPRTHKWSYSGSCPKSLEDSSWIPFRDHCYTFHMEITLGQKD
AMRRCQKVGGTVLSIQDEMENVFVWEHLQAYEGQSKGAWLGMTFNPKGGTLVWHDNTAVN
YSNWGQHDTGPSMLSQNSCYWIQSSNGVWRLGSCTNVTMGVICKIPRVEESSFSRAALPE
NTTAIAVVVLSALALSALLGIAIFLYKRRRSSERGAFESARYSRTTSNPSEAAEKNILVS
DMEMNEQQD
Download sequence
Identical sequences ENSGALP00000000626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]