SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002221 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002221
Domain Number 1 Region: 726-1078
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-54
Family Ankyrin repeat 0.0000507
Further Details:      
 
Domain Number 2 Region: 455-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.63e-48
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 222-410,441-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.14e-47
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 49-158
Classification Level Classification E-value
Superfamily POZ domain 9.42e-19
Family BTB/POZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 1103-1162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002221   Gene: ENSGALG00000001467   Transcript: ENSGALT00000002223
Sequence length 1168
Comment pep:known_by_projection chromosome:Galgal4:19:3174883:3199044:1 gene:ENSGALG00000001467 transcript:ENSGALT00000002223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASAEEVAKLEKHLMLLRQEYVKLQKKLADTERKCNLLAAQANQDNASDTFISRLLAIVAE
LYQQEQYSDLKIKVRDKHISAHKFVLAARSDAWSLANLASTEELDLSADADPEVTMAMLR
WIYTDELELREDDIFLTELMKLANKFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNA
STLLNYCAEIIASHWDDLRKEDFSSMSAQLLYKMFKSKTEYPLHKAIKVEREDVVFLYLI
EMDSQLPGKLNELDQNGDLALDLALSQRLESIATTLVNYKADVDRADKRGWSLLHKAIQR
GDKFAANFLIKNGARVNAATLGDQETPLHLVASYSPKKHSPDVMAEMAQIAESLLQAGAN
PNMQDSKGRTPLHMSIVVRNEPVFSQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDQS
VNPFEDAPVVNGTSFDENSFAARLIQRGSNTDAPDTVTGNCLLQRAAGAGNEAASLFLAT
HGAKVNHQNKWGETPLHTACRHGLANLTAELLQQGANPNIQTAEVAPGQKDASSPTAESV
YLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGM
HTIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQL
AIKNQLPLVVDAICTRGADMSVPDEKGNPPLWLALENNLEDIASTLVRHGCDSTCWGSGP
SGCLQTLLHRAIDENSEQIACFLIRSGCDVNSPRKPGPNGEGEEEAHDGQTPLHLAACWG
LEEVIQCLLEFGANVNAQDAEGRTPIHVAISNQHNVIIQLMISHPEIKLNVRDRQGMTPF
ACAMTYKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRV
QDASKLTPLHLAVQAGSEIIVRNLLLAGAQVNELTKHRQTALHLAAQQDLPTICSVLLEN
GVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECNVDAEAFNIRGQSPMHILGQYGKDNA
AAICDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRAGARLGVNNNQGVNIF
NYQVATKQLLFRLLDMLTKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTKE
IPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences ENSGALP00000002221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]