SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002310 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000002310
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.000532
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002310   Gene: ENSGALG00000001521   Transcript: ENSGALT00000002312
Sequence length 336
Comment pep:known_by_projection chromosome:Galgal4:24:2543070:2549943:1 gene:ENSGALG00000001521 transcript:ENSGALT00000002312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFFGFGQSAEVELVLSDAESRRRVEHKTEEGKKEKYFLFYDGETVSGRVILTLKHPNRR
LEHQGIKVEFIGQIELYYDRGNHHEFVSLVKDLARPGEFTQSQIFDFEFTHVEKPYESYT
GQNVKLRYFLRATVSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTSSHTEAKTPSQPAENNGRQ
Download sequence
Identical sequences F1NPH4 G1MS48
XP_003212753.1.16129 XP_021231648.1.32913 XP_417878.1.86415 ENSMGAP00000001087 ENSMGAP00000001087 ENSGALP00000002310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]