SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002348 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002348
Domain Number 1 Region: 201-378
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-31
Family APC10-like 0.0025
Further Details:      
 
Domain Number 2 Region: 1816-1877
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000954
Family ZZ domain 0.007
Further Details:      
 
Domain Number 3 Region: 1774-1825
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.022
Further Details:      
 
Domain Number 4 Region: 85-147
Classification Level Classification E-value
Superfamily EF-hand 0.00000242
Family Calmodulin-like 0.06
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000002348
Domain Number - Region: 1095-1188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000955
Family Spermadhesin, CUB domain 0.0068
Further Details:      
 
Domain Number - Region: 2672-2761
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0471
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002348   Gene: ENSGALG00000001546   Transcript: ENSGALT00000002350
Sequence length 2924
Comment pep:known_by_projection chromosome:Galgal4:19:3208979:3261139:1 gene:ENSGALG00000001546 transcript:ENSGALT00000002350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTAASHSSEEEEEGAEEGMEAAAQPGDPFPAASPAPPLPPAEVLLEQARLREATARLRE
AALPESLVSRHHGALVRWLEERLSRGDEAVSLEQFCEVLESVSRLTAGSRGESEEAFAQF
DAEGDGTVDVENMLEALKNSSGANLQGELSHVIRQLQACSLVPGFIDIFSESKERLGLHA
SMILRFLHRNRISSTAIPYPVLEYFNNICMMRSSVLKDSLDRLLLKEREYPSDLNGNEES
DKLKSVTKCYTHIETSSNSADIDKMTNGETTSFWQSDGSARSHWIRLKMKPDVVLRHLSI
AVAANDQSYMPQQVTVAVGRNASSLQEVRDVHIPSNITGYVTLLENANISQMYVQINIKR
CLSDGCDTRIHGLRAIGYQRVKKVGVSVCDASAIWYWSLLTSLVTASMETNPAFVHTILQ
NTQKALQHMPPLSLTPSSTDFSSFLSPNVLQEVDSFLIRITSCCTTPDVELTLLAFALAR
GSVAKVISSLCTITDHLDTPYKASSLIASMATVRQNLLYKYGKPLRLTLQACDVKGKEDK
SGPENLLVEPWTGDGFLTETGKTRASIILSTGTESSFQVTQIRIKVRRGAIGAQCGLVFA
YNSASEKFHAEEHFKRFESYDKWKLKDFKQFLKNRSGSSSDELGDDDPIGWFEVEEEWDE
VDVRMQQCRVAQYLMIKFLCTRQDTAERLGVQGLNVLGYLRPMREEPSRSMHCLQCRKTD
DETVCGTTLLLKTLHFIQQLAQDLVQQKESGLKCKSYLDFTDLDLQLFWNFYNKLHQNPR
EECIFAQTLLLQLLQSCFSVFTGDNKTSKPQETLQGRTPGHTKAAEDLYRHLCEGTVVDM
GDTNFMPVKMLKQEVKNTLLSGAAIFFPDRQTRRNQLFAMMKNITEQEHKQSVHLAFRSL
CTHFSDQDPGGLLLLPEKGVSANFDISEVLSVMDTLLLVAARECEMMMLDVAQQESGTVL
SSLFWSVQGSLLSWCYLQLKGSDSSAKDLAVEILKNYVGQFLTNVRMILQSLLSQYSGKT
IVEKISNSVFAMATRQLVIFLLDFCTLDIPYCTLLQEFSTLVEPLKKLCSEPHKMEIESW
QQEQPVVLRTWTVESPHNYENNCHEVSVFLCHGASYFEVEFDEKCETERRYDYLEFTDAR
GAKTRYDTKVGTEKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWGL
DLQLLVCRLMGRLASRSMALKSQRELGSEADLPPLKVTSVLNSPLWKPVFRHQMCPEAEP
GASETSRGHQDKKEARSSHQDDCRNFLIDFARSDPAQDFSGQKSELFKGLVQTCRKQTPK
TDTVAGSTVDRAVNSTFAALVYLTPALYEKLQKYVNSGGKVPLSDEFAQVYSLADSIRIW
MLEMKQKSLMGRGNDTEEKQSTEASEVNPETLAKLCMQKSLLLLNFLPVRVKTKGSTSDS
LEAQDGDNVHQYVNDRNQRKSSVVETDFQAAHSSSSSGVTRSVSVEGEQTTQSDTKIKQI
SDPLQTEEQEDVPSPPSTPTRKSQFSRGRLRLLSFRSMEEPRAVPTLKEKYPILKSILDF
IKDQSLSHESVLKVLALRKSQGQNILEVLRTIRRCLDSLGQPHCFHPPCVLFLLELLACQ
KDFTNYFGNLEGCGAALHKEIRESYYQLVLFLVNSVKGFSAITDRSLLPALSCVQTTLLH
LLDMSWEPTDLSFFVEIQLPQLLMATSQENISIHDSVICQWSEEDEIADYKQNCEWMDEC
QDIMFESWYEKIAQADPEKQRKMHMFVARYCDLLNVDISCDGCDEIAPWHRYRCLQCNDM
DLCKTCFLGGVKPEGHEDDHEMVNMEYACDHCQGVIIGRRMNCNVCDDFDLCYGCYSAKK
YSDSHLPTHSITVYPMVTIRISDRQRLIQPYVHNYSWLLFAALTLYSADLANGEEVEGEK
LDSQVLSHARILQHQCIQLIGDCLMKAQQGKGLKNLALLCMLPEGESLSENDTASVSPPT
DGAPKSHTGDKAEALILISCVTSRIKSSQLNVDLQKCWRKGAKDIAERQESELSMEDNIT
PTGKDYFPFFLSQKHPSICKTLLKQAEKVLIPSQEQVFAECSQKRILGLLAAMLPPFKSG
STMSLINLEQILPLMFQVVISNAGHLNETYHLTLGLLGQLILRLKPAEVDAAVAKVLSTK
HSFRVGLDWASSMADILRSLNSSAQWHSVIAAFTDHCIKQLPFQLKHTNIFTLLVLVGFP
EVLCMGTRSVYMDNANEPHNVIILKHFTEKNRAVVVDIKTRKRKTVKDYQLIQKCEQEGS
DSQAQLRQYLQHFVLICTHLLQTTIDSSYAEAVEATWVLSLALKGLYRTLKIHGFQEVQD
AFLHSGLLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYSSKKEISSLAEREDTELEEREQ
DQDVEQSIVGPADVEQNKLDPLEGLDEATKICFLMTHDALNAPLHILRAMYELQMKRTES
FFLEVQKRFDGDVITTDERIRTLAQKWQPSKRLRLEEQSSKAVDTDMIILPCLSKPVLCD
KATEETNPVAQKLITNTESDLQLSYAKQRRTKSSILLHKELDSRSKKAVRDYLYRVNEAT
AVLYARHVLASLLAEWPDDVAINEEVLDLSGPAHMTYILDMLMQLEEKQLWEKILQKVLL
GCNESMLGTMALTACQFMEEPGMAVQVRESKHPYNNNTNFEDKVQIPGAIYLSIKFDSQC
NTEEGCDELLMSSSSDFQQDRHSFSGSPQKWNDFELPGDTLYYRFTSDMSNTEWGYKFTV
TAGHLGRFQTGFEILKQMLSEERVIPHLPLARIWEWQVGVACRQTGHQRLKAIHLLLKIV
QCSAQRDCDLTLLKPLWQLFTHMENNICHDVTKPGILLPLHRALAELFFVTENRVTELGS
LQEYLLALNSEDHLHRCTAQALRNIAAISLAINYPNKSTSFWNV
Download sequence
Identical sequences ENSGALP00000002348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]