SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003336 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003336
Domain Number 1 Region: 44-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.63e-127
Family Bee venom hyaluronidase 0.00000812
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000003336
Domain Number - Region: 434-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00407
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003336   Gene: ENSGALG00000002138   Transcript: ENSGALT00000003341
Sequence length 478
Comment pep:known_by_projection chromosome:Galgal4:12:1408294:1410676:-1 gene:ENSGALG00000002138 transcript:ENSGALT00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGCAAVLALVPALPWLVPAVLAVLARQSPEKPSAAPLLTRRPFLVAWNAPTQDCKPRF
QVALDFSVFDLQASPNEGFVDQNLTIFYKERLGLYPYYNKQGKPVNGGVPQKSSLAEHLA
RLQENIGKYIRSATSEGLAVIDWEEWRPIWMRNWKPKDVYQEVSRELVEQRQPFWSPEKV
NKQAVFEFESAARHFMVTTLRYAKSFRPKQLWGYYLFPDCYNHDYSKNKESYTGQCPDVE
KTRNDQLAWLWNESMALYPSIYLDPLLASTPNSRKFVRARVMEAMRISQQHHEGYSLPVF
VYTRPTYSRKMDVLSQPDLISTIGESAALGAAGVIFWGDVEYTKNRESCQTIKDYMEGDL
GRYIVNVTMAAQHCSITLCHGQGRCKRRNSTANVFLHLNPATFQLQRRDEEQPQRPLIWA
KGHLSHTDVHFLQTHFRCHCYQGWQGNSCQQSAGPHGSAPGPLAPMGLGVLLVFWMWC
Download sequence
Identical sequences H9KZ20
XP_414258.2.86415 ENSGALP00000003336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]