SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003731 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003731
Domain Number 1 Region: 437-617
Classification Level Classification E-value
Superfamily SPOC domain-like 2.71e-49
Family SPOC domain 0.00032
Further Details:      
 
Domain Number 2 Region: 71-226
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-30
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003731   Gene: ENSGALG00000002372   Transcript: ENSGALT00000003739
Sequence length 619
Comment pep:known_by_projection chromosome:Galgal4:12:2215171:2217030:1 gene:ENSGALG00000002372 transcript:ENSGALT00000003739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVTSPLLREPRPRHAHAAAAAFALEAAAIGLSRERERALDYYGLYDERGRPYSYPIVAEE
DLMPEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQ
NLDMAHRAKVAMSGRVVGRNPIKIGYGKANPTTRLWVGGLGPSTSLAALAREFDRFGSIR
TIDYVKGDSFAYIQYESLDAAQAACAQMRGFPLGGPERRLRVDFAKAEETRYPQQYQPAP
LPVHYELLADGYSRHRSLEQDLRVRDRTPPHLLYSDRDRSFAEADWASPAKNAERRNNLE
SYSRSVRSRSGERWASDSDRAVPKLWEERRKRRSLSSDRGRTAHSPYEDRSRTKASGPAL
DRSPERARKENHTTESGTEKEQSNSLQNNRHATEEKPHREASDAPQPKKRDSERNHRTGE
SESKAHEEPKSETKKLKNLSEYAQTLQLAWNGLLVLKNSCFPTSMHILEGDLGVINGLLK
DHSSGGKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQSAPGGAGAEGTFPV
VEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGAKGRDSTGMLYAFPPCEFSQQYLQSALR
TLGKLEEEHMVIVIVKDTA
Download sequence
Identical sequences ENSGALP00000003731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]