SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004246 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004246
Domain Number 1 Region: 189-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-52
Family DBL homology domain (DH-domain) 0.00000131
Further Details:      
 
Domain Number 2 Region: 2-214
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.2e-40
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-33
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 658-759,807-833
Classification Level Classification E-value
Superfamily SH2 domain 7.69e-25
Family SH2 domain 0.00088
Further Details:      
 
Domain Number 5 Region: 561-651
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-16
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 6 Region: 760-835
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000048
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004246   Gene: ENSGALG00000002699   Transcript: ENSGALT00000004255
Sequence length 839
Comment pep:known chromosome:Galgal4:17:7049744:7148021:-1 gene:ENSGALG00000002699 transcript:ENSGALT00000004255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSDLFDPFDLFDVRDFGKVISAVSRLSFHSI
AQTKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIRVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYYKTLEDIEKNYMNPLKLVLTPQDMEAIFINLE
DLIKVHFNFLRAIDVSMMSGGSSLAKVFLEFKERLLIYGKYCSHMEYAQNTLNHLIANRD
DVRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSSDRPEKQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDIKKWSYGFYLIHLQGKQGF
QFFCKTEEMKRKWMEQFEMAMSNIKPEKANANHHSFQMYTFEKTTNCKACKMFLRGTFYQ
GYLCPKCGAGAHKECLEIIPPCKMGSSADQDLLSAGPGPKMVAVQNYHGNPAPPGKPVLT
FQIGDVIELLRGDPDSPWWEGRLLQTKKSGYFPSSSVKPCPVDARPPNSRPPSREIDYTV
YPWFAGNMERQQTDNLLKAHVSGTYLIRERPAEAERFAISIKFNEEVKHIKVVEKDNWIH
ITEAKKFESLLELVEYYQNHSLKESFKQLDTTLKYPYKSRERSTSRTFTRSPVFTPRVIG
TAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRVGWFPSTYVEEEGVQ
Download sequence
Identical sequences ENSGALP00000004246 9031.ENSGALP00000004246 XP_010719283.1.16129 ENSGALP00000004246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]