SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004660 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004660
Domain Number 1 Region: 866-924
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 59-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000994
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 636-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 757-811
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 5 Region: 806-871
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 581-639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000115
Family TSP-1 type 1 repeat 0.0094
Further Details:      
 
Domain Number 7 Region: 704-754
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000012
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004660   Gene: ENSGALG00000002955   Transcript: ENSGALT00000004669
Sequence length 968
Comment pep:known_by_projection chromosome:Galgal4:17:6972901:6991273:1 gene:ENSGALG00000002955 transcript:ENSGALT00000004669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRRMKMFRWRWSSISVSVRSRLRAALALLVVGNVAFVIAQDLPQTSNSLEEGADVTAYW
WGEWTKWTACTRSCGGGVKSQERHCLRQRRKSVSGLANKTCTGTSKRYQLCRVQECPANG
RSFREEQCSSFNSHVYNGRTYQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVQARDGT
SCKYTDFRGVCVSGKCEPIGCDGILFSTHTLDKCGVCQGDGSSCTHVTGSYRKGNAHLGY
SLVTHIPAGARDIQIVERKKSADVLAVADEAGYYFFNGNYKVDSPKNFNIAGTVFKYRWP
MDVYETGIEYIVAQGPTNQGLNIMVWNQNGKNPSITFEYTLLRKPHSNLQPIYYTFSESD
SEESREFDGDVPLGFIQHNATYFGKISRERIDLENQVFGRQDTEEDLNLSKGQETNEVYE
RAETIDCEPKLKGKQPKDPNVTRSTYQTDPDDRDFDPTFTSREFLSENAITDKLLDKASD
SKELVLNMTMNSIFAQGDPINSVGSHIDSLYVDYEDSDGIVTYTINGTYMELSNSKAINS
SAETPFSNATVTMTSSQGNRTHKARNRLKLLRKGQGVSAADMYRWKLSSHEPCSSTCTTG
VMSTYAMCVRYDGIEVDDTYCDAMTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQ
FRIVRCWKMISPGFDSSVYSDLCESADITRPDERKVCKNPACGPQWEMSEWSECSARCGE
RSVVTRDIRCSEEEKLCDASARPLAEKNCTGPPCDRQWTVSDWGPCSGGCGQGRMIRHVY
CKTSDGRVVPESQCNLETKPLAIHPCGDKNCPSHWLAQDWERCNTTCGRGVKKRIVLCLE
IVNGKIKTHSPTDCDVAKKPVEETTCFERPCFKWYTTPWSECTKTCGIGVRMRDVKCYQG
KDIVRGCDPLVKPVGKQTCDLQPCPTEPPDDSCQDQAGTNCALAIKVNLCSHWYYSKACC
RSCRTPHS
Download sequence
Identical sequences ENSGALP00000004660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]