SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004962 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004962
Domain Number 1 Region: 495-666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-51
Family SPRY domain 0.00046
Further Details:      
 
Domain Number 2 Region: 55-124
Classification Level Classification E-value
Superfamily RING/U-box 1.25e-16
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Domain Number 3 Region: 188-251
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000183
Family B-box zinc-binding domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004962   Gene: ENSGALG00000003144   Transcript: ENSGALT00000004971
Sequence length 672
Comment pep:known_by_projection chromosome:Galgal4:18:6254682:6261401:-1 gene:ENSGALG00000003144 transcript:ENSGALT00000004971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPGADPPRPSGGGEMPRNTPESRSPSFVSSQPDGSSGRMATLTKAQSEPNLLALEEDLT
CSICLSIFDAPVTVPCGHNFCAYCLEQTWASQVRDFSCPQCRTTFPDRPQLHKNTVLCRV
VEQLQGCGDGKEDDEHEEEEQEAAAPIYCDSCLQAAATQTCLTCMASFCPEHLRPHYDSP
AFRHHQLCPPVRDLQQRKCPQHNKLFEFFCSQHSCCICSLCLLSHKLCHTSPLQQAKDNA
ESALKKRLAELHNQSERSVQAMNSVKTIQRQAAETAARKRDLLRAEFLEIKALIEEKENQ
TLKVFMEEEKRVCNKFDYVYKILGNKKNEIQSLRDQIEMALTEGDDVLFLKRAAALQRTS
IKEAFVPVIEMDNNMIHAAYQSAINLKDVVKLAVNVSVDKRTDAKPPPGKTKPPSVPSPN
KPVVKKKLAADSRTHKDKIPHPTKTTLLEETDTQDKRNPVKLAPSMGAPSMGAPSAANAA
KVKELISSFLKKPRAELLQYAANVTLDFNTAHSKVALSERYTKMSVSDTQLNYNHHPQRF
TDCPQVLGFQCFKRGIHYWEVEMQQNNFCGIGICYGSMERQGPDSRLGRNSSSWCIEWFN
SKISAWHNDVEKCLPNTKATKIGVLLHCDGGFVLFLTVEEKLNLIYKFKAQFTEAVYPAF
WLFSSGTVLSLW
Download sequence
Identical sequences ENSGALP00000004962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]