SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005366 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005366
Domain Number 1 Region: 19-162
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-30
Family C-type lectin domain 0.00000938
Further Details:      
 
Domain Number 2 Region: 236-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 357-428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000113
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 296-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 411-477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 177-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005366   Gene: ENSGALG00000003399   Transcript: ENSGALT00000005376
Sequence length 529
Comment pep:known_by_projection chromosome:Galgal4:8:5097326:5102707:1 gene:ENSGALG00000003399 transcript:ENSGALT00000005376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSAENYLSGLTILEMVNCWTYHYSDTNMTYKEAELWCKKRYTNMVAIQNKDEINHLNDFL
PFNPSYYWIGIRKINGTWTWVGTNKELTKEAENWASGEPNGKGNNEDCVEIYIKRGKDDG
KWNDEKCEKKKVALCYTASCNSSLCSGRGKCIETINNYTCHCNPGFYGPGCEFVETCDPL
KKPDHGSLECNHPLKDFSYNSSCTAQCEEGYELNGLESVYCTSHGWSGPLASCTAVRCDA
VTWPEEGSVNCSYAHPTYGSRCDFRCREGYVLEGPSSTECMAQGQWSEPFPKCKAVTCTV
LKAPANGSLNCSRSSEFTWNTTCEFTCEEGFALTGQSTLHCGSSGAWDKQQPSCAAVRCD
AVTWPEEGSVSCSYADPTYGSRCDFRCREGYVLEGPSSTECMAQGQWSEPFPKCKVVQCE
PLKSPEKGSMDCIHGAGNFTYNTACHFSCLEGWNLNGSRVLECSHSGNWSASLPTCEASQ
QVAYVTVGIAATTTSLLATASFLFWLAKRLRGKAKKFTPASSCQHLTTE
Download sequence
Identical sequences ENSGALP00000005366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]