SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005401 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005401
Domain Number 1 Region: 184-252
Classification Level Classification E-value
Superfamily Homeodomain-like 1.24e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 61-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000919
Family LIM domain 0.0065
Further Details:      
 
Domain Number 3 Region: 31-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000177
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000005401
Domain Number - Region: 122-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0217
Family LIM domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005401   Gene: ENSGALG00000003424   Transcript: ENSGALT00000005411
Sequence length 380
Comment pep:known chromosome:Galgal4:8:5141844:5166718:1 gene:ENSGALG00000003424 transcript:ENSGALT00000005411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGLKMEETLQSALDPAAPFSSLLGRAATPRSVCEGCQRVIADRFLLRLNDSLWHERCV
QCTSCKEPLHTTCFYRDKKLYCKLDYEKLFAVKCAGCLESIAPSELVMRAQQSVYHLHCF
CCCVCERRLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPALSDSGKSDDEDSVCKMGPA
SAKGAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQV
WFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQPNSSGPGGLEGLMNPYTALQPPQQLLG
MEQVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDMDSDDTSLSNLGDCFLATADAGPLQ
TRAGNPIDHLYSMQSSYFTS
Download sequence
Identical sequences E1C2D6
ENSGALP00000005401 NP_001244317.1.86415 XP_015145820.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]