SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007560 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007560
Domain Number 1 Region: 51-99
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 2 Region: 12-54
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000034
Family Somatomedin B domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007560   Gene: ENSGALG00000004751   Transcript: ENSGALT00000007572
Sequence length 238
Comment pep:known chromosome:Galgal4:20:6832941:6843420:1 gene:ENSGALG00000004751 transcript:ENSGALT00000007572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSCPACRPAMPRCPGRAAALPPPYGPCYCDQACEHTLDCCHDYSQACPVIPCVVSQWSA
WSGCAEPCKTTYRVRRRHIIQEPRNGGEACPALEERAGCVEYWTEQGTECKQSLIPAFIT
TGGFGKARKKRAATDGRERVGYCVEFQLVAITQGCLHSHHSYTHWMQYLREGHTVCVECQ
HPALDSESLHCYGDGSGSQRNQLLHWQAVGNPRCSGTWKRIRQLDTCSCPSVHSFLFI
Download sequence
Identical sequences ENSGALP00000007560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]