SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008208 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008208
Domain Number 1 Region: 807-960
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000196
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 958-1085
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000518
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 616-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000656
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 4 Region: 697-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000259
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 731-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000008208
Domain Number - Region: 129-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.00126
Family VWC domain 0.024
Further Details:      
 
Domain Number - Region: 457-563,615-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008208   Gene: ENSGALG00000005120   Transcript: ENSGALT00000008222
Sequence length 1196
Comment pep:known_by_projection chromosome:Galgal4:12:5783474:5867616:1 gene:ENSGALG00000005120 transcript:ENSGALT00000008222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRHQSWQRSCLNAAFFMLLWSGVSHAQRDCTGVECQPLDNCIEDVLEPGECCATCLQHG
CTCEGYQYYDCVNVGFVNGKVPEGQSYFVDFGSTECSCPKGGGKISCQFMLCPELPPNCI
DAVVPADGCPQCGRIGCLHEGQKYVAGHTFHMPPCKVCHCPNAGGELMCYQLPNCNTFAL
NTVSPMDAEDNEPERHYDDPYSYDQEAPEGDNAQVESPKKYRSYSSHLEQESISQEQSED
YDYLPVSIAPSSSAVAGMYAEETTTPLTTPAPKLLSEFRSATERTEWKRVPSTTAPPPQQ
TTHKEAPVTTSAPLEHTTATTETPKQLGKLDRRPKGKQGDKEKSEQERTPHSKMKKHTRK
EDPGNSIHLDLKEVNLTEPSSAKSSQETHEGNAFPKVKFSATTSPPVALKEDRSQSSQKQ
SQTLYRYHPEEDGDPNSIHANPRLPEGSTKELIESCCGAGQQWAIDNGECTETPISGVDG
DICRIAQKQCCISTVKENSCLAGMIAAKEGDACGPEESDNCGGSSYKQCCDCCNLGLRLR
SEGKTCESNINLGYPCSHVMLSCCEGGDHFIHPEIKKHPEPSPTATPEKISETEDHNEAL
SISNEAELSNNLPGDDLDECLLYGGELCQHLCINTVGSYKCSCFPEFTLQEDGTSCSPDP
DRGQVTRLEVEATIPPAASPQPLLIVSLQEEQDKCKDNGPCKHICSVMEGNVVCSCLSGY
TIMADGISCEDINECVTDAHTCQRREHCVNTMGSFKCLQELSCQPGYELKDGECVDIDEC
ERGTHSCKVNFVCQNTEGSFYCESKQRCMDGFLQDPEGNCVDINECTSLPEPCKPGFNCI
NTVGSYTCQRNMLTCSRGYHSNEDGTRCVDVDECQTGVHRCGEGQICHNLPGAYRCDCKM
GYQYDAFSRSCIDINECWNYPGRLCQHTCENTPGSYHCTCSSGFHLSYDGKHCEDVNECD
TSPCSQECANVYGSYQCYCRQGFQLAEDGHSCKDIDECTQSAGILCTFRCVNVPGSYQCA
CPEQGYTMAANGRTCRDIDECAIGTHNCSAAESCYNIQGSFRCLSFECPSNYRKVSDMRC
ERISCFNYLDCQNTPVRITYYQLNFQTNIMVPAHIFRIGPSPAYAGDNIILTINKGNEEN
YFSTRRLNSYTGIVYLQRQVKEPKDFLLDVEMKLWRQGTYTTFLAKIYIFITAHTY
Download sequence
Identical sequences XP_015148926.1.86415 XP_015148927.1.86415 XP_015148928.1.86415 XP_015148929.1.86415 XP_015148930.1.86415 XP_015148931.1.86415 XP_015148933.1.86415 ENSGALP00000008208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]