SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008360 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008360
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-29
Family Hormone receptor domain 0.00034
Further Details:      
 
Domain Number 2 Region: 120-409
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000494
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008360   Gene: ENSGALG00000005212   Transcript: ENSGALT00000008374
Sequence length 419
Comment pep:known chromosome:Galgal4:2:1146175:1164231:1 gene:ENSGALG00000005212 transcript:ENSGALT00000008374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYHCVLYTLTLAVLVAGNVHPECDFIAELKKKEAECLENSEEHENATSGCKKTWDKLLC
WPEADAGETLALPCPDILFHFMEEPAGIVRRNCTKKGWSEPFPSYHIACPVEDEIPLEEQ
SYFSTIKIIYTVGYSLSITSLIIAVTVLMAFRRLRCPRNYIHIQLFFTFILKAIAIFIKD
SVLFQEEDIDHCSFSTTECKISVVFCHYFMMTNFIWLLVEALYLNCLLLSSLSHGRRYFW
WLVLFGWGFPTLFTFIWILAKFYFEDTACWDINQDSPYWWLIKGPIIISVGVNFVLFINI
IRILLKKLDPRQINFNNSSQYRRLSRSTLLLIPLFGTHYIVFNFLPEYTSLGIRLYLELC
IGSFQGFIVALLYCFLNQEVQTEIGRRWHGKRYGLMPVWRRTRWTVPTSSGVKMNTSVC
Download sequence
Identical sequences Q309X7
ENSGALP00000008360 ENSGALP00000038473 NP_001032923.1.86415 9031.ENSGALP00000008360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]