SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008410 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008410
Domain Number 1 Region: 16-109
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.4e-22
Family Hormone receptor domain 0.00017
Further Details:      
 
Domain Number 2 Region: 112-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.56e-16
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008410   Gene: ENSGALG00000005242   Transcript: ENSGALT00000008424
Sequence length 440
Comment pep:known chromosome:Galgal4:2:1480605:1505475:-1 gene:ENSGALG00000005242 transcript:ENSGALT00000008424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLCWLLLLPLVVGIHPECKIFQQVVKEEALCLERNESASPDLKGCARDWDGLSCWPRA
ALGEIVKIPCPRFFEEITNIHGFLQRNCTQEAYWSEPFPSYAVACGFDEGSSKGPEDQKS
YYSAFWRVYTAGYAASVTSLITALIVFAAFRKFHCTRNYIHMHLFVSFILRAIAVFTKDA
VLFADETMDHCLMSTVACKAAVAFFQFSILANFFWLLIEGIYLQTLLLLTFVSDKQYVWW
FIFAGWGAPTAVMLTWVLTRLHQQNTGCWDDDENGVVLWIIKGPILLTVLINFIIFINVI
RILVHKLKSQEGGGSNSSHFVRLAKSTLLLIPLFGVHYIVFAFFPESTGLEARLYIELGL
GSFQGFFVALLYCFSNAEVQSELKKQLCKWRYQEYLSFTHKQGTVSRENSPVNYVTQLSL
LEKNSPKRKTSAYQNGVTSV
Download sequence
Identical sequences ENSGALP00000008410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]