SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008702 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008702
Domain Number 1 Region: 2056-2183
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-29
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1740-1852
Classification Level Classification E-value
Superfamily CalX-like 5.49e-19
Family CalX-beta domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008702   Gene: ENSGALG00000005426   Transcript: ENSGALT00000008716
Sequence length 2184
Comment pep:known_by_projection chromosome:Galgal4:Z:31576518:31643574:-1 gene:ENSGALG00000005426 transcript:ENSGALT00000008716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPFEKTWLLLLLPVLLRVVCSSFVSVNLGIKVMKGQSVFLSEDDLKFSIPREKDVCKVE
VVRNEPITQRVGKLTPQVFDCHFRLNEVKYTHNGCPILNADTVMLRLYRFTENETFVETF
TLHVQLLEPDCNIIKMRSRALEVAEYYGLSRAIDKNSLTFDYSRKMNLECTISIASSETH
LPAHGQLIMGDTRQEKLRGDQPQSFLLGPKHSPGQQCRNGSCVLGLRVIHNTKMSCEEFL
RKGIRYQHLDPRSPDIDYIPVRLDLTDSRSKTLHKTEYAWLPVRIKSAMPNQIPKAVPMT
KFILEVDQFILTPITTTTVDAEDKETPKSLLVFNITKPPLQGFITHLSDHTKPVGSFTWK
DLSEMLIAYQPPNNSHTERRNYELEVEVHDFYFERSLPTIVQLSIRTADTNAPRVSWNTG
LSLLEGQSRPITWQHLQVVDNDDIQNVRLVTVDGLQHGRLTVRGGKGFMFTVSDIQTGVV
RYHHDDSDSTKDFVVFRIFDGLHSIRHKFPINILPKDDSPPFLISNVVIEVQEGQTILIQ
GSMLQASDMDSSDDYIVFNITKPPQAGEIMKKPGPNLIGYPVSSFLQRDLFNGIMYYHHL
GGEVFEDSIEFVLCDSHDPPNLSEPQVMTVHISPVDDQLPKEAPGVTRHLVVKETEIAHL
TKKHLHFIDVEEQDRELTYTITTSPFFSCVHGHSDAGKLFMVDTIPKLVKDPAALALRSF
TQHAVNYLKVAYMPPLQDIGPNPQHVQFVFSVSNQHGGTLYGICFNITILPVDNQAPEVL
TSHLRVEEGGLSPVTEGHILVSDVDTKQEHLLLLLQRQPQHGAVELDGVPMEEGDKLSCA
DLRTLAVSYRHDGSETLTDEVLFVATDGIHSLEFTLQVKVLPMNDEPPVMQTGLINVLSC
PEGEEVVLSSEYIYATDADSDDMKLVFVLVRQPSQGVLRRAGIAVERFSQADVISGLVTY
KHTGGEIGLTLAFETLTFVVSDDEAGPDVKDCCYDRPLPPPVPLHRPLPVYDLNITVLPV
DNQPPSIAIGARFVVEEGSSAALTSNHLFATDPDTPADDLEFVLVSPPQFGYIENILPSP
GFEKSNVGISIASFQLKHLKALNINYVQARHMRMEPRADHFVLYVTDGLHRSAEIPFFVL
INPTNDEVPEFIARNITVQEGMMKELDLSVISAVDLDVPQDQLVFGVVQQPSHGFLINGV
HGNDILHYKELIQHHNHGLLVHDFSMELLQNGMKLMYMHDDSESLSDSFKIQLSDGKHKV
LRTISVKVIPVNDEKPVLSKKDNIEVHMGETRIISSAVLSAEDKDTPRERIYYLFERLPE
SGQLQLKVGRDWVTLQTGMKCTQEELDMNLVRYVHTGAIGSKNQDLFTFYLWDGYNRSPA
VDFYINIKDMEKGDIAVFIKPLKVSKGDRGYITTDVLLSLDGTDKPEELLYVITSPPQYG
QIEYASYPDIPITSFSQMDVASQIVCYVHNTKAHSRQDAFRFIISNGLRTKHGTFMISLE
AVDQTLPTLSRNRGLRLVEGNMVLLSPDVLQLTDSDTAKENLTFILAQLPQYGHLYYRGA
VLLQYSFTQRDVDNMDVAYKHRGGDSRVDKFTFVATDRTNQGFIVNGRVQIEPVAFTIQV
DHLDKMAPKIIHLRCLSDVEMLKNGNYGIYITSRSLKATDPNTEDDKIFFKILQGPRYGY
LENITTGGLIHEGFSQKDLNSKIIFYVINPLWEVHSDNLEFQVTDTNGNSAIPQMLELRW
SRIEMQQTEYEVCENVGTVSLKITRAGHSADSAFIAVKVNEISAVLGKDFTVTPSKLIQF
DPGMSTKMWNIAITYDRLEEDDEVFEVVLNSSVNAVLGTKTKAVVKILDSKGGQCSTLHS
SSQSKQDFWRRGTLFAVSSGSSSPPRPGNVHLEGISPPPSKRMREHRGDTLQDRRLAYQS
RAKLRVTGNGRIVHPSSIFRNGTDVVYKYHGMVSLKIEGDTSSAKANKKAEVSVINQAQP
QINAISTRKTEIPQADKAELASEASSRRQDFHSFSRACTPDLKGLMHYEESTQKLFQCDG
IEWKFWSSQSKEASMKKCPSGWRHRDGSCYFLVVNQKVTWDTAAQACREQYLGSLTSVAN
EQHMQWLWDFGGRKPFWIGLNDQVNPGHWEWNGGEPVTYINWRRGSYRFTKRGNNCVVVQ
KRGKWQATDCRKAKWNSYICSRKL
Download sequence
Identical sequences F1P5W0
XP_004949159.2.86415 ENSGALP00000008702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]